Quiet essentials · Free shipping over $75 · Shop the edit

ABHD14B Polyclonal Antibody-BS61119 Size:100µl Specificity: MSH3 Antibody detects endogenous

SKU: 81809401050

4.2
USD130.12 USD167.12

Pay in 4 interest-free payments of $32.53 Learn more

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 30 - Aug 4

Description

Specificity: MSH3 Antibody detects endogenous levels of total MSH3

Catalogue Numbers: BS77993-50

Specificity: LUZP1 Antibody detects endogenous levels of LUZP1

AA Sequence: AVQGPEEt VTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQ

ABHD14B Polyclonal Antibody-BS61119 Size:100µl Specificity: MSH3 Antibody detects endogenousABHD14B Polyclonal Antibody Catalogue Numbers: BS61119 50, BS61119 100 Sizes: 50l, 100l Product: Rabbit IgG, 1mg ml in PBS with 0. 02% sodium azide, 50% glycerol, pH7. 2 Swiss Prot: Q96IU4 Host: Rabbit Reactivity: Human, Rat, Mouse Applications: WB All Applications: WB: 1: 500~1: 1000 Background: The hydrolase superfamily comprise diverse members that are involved in important biochemical processes and related to various diseases. They have unrelated

Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

You may also like

recommand products